PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00006.1.g06150.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 166aa    MW: 18543.6 Da    PI: 4.8755
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00006.1.g06150.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like26.11.9e-084342555
                       G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                    AtPk+i  lm+v+++ ++++  HLQk+R 
  Zjn_sc00006.1.g06150.1.sm.mk  4 TTATPKKIELLMNVNSIDRKQISAHLQKHRK 34
                                  57***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-6536IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MIPTTATPKK IELLMNVNSI DRKQISAHLQ KHRKRMDKEL KDSMLLKKAG KNSSSSRRLR  60
KSCEEAVSEN NDIQPEDRTV TENIIRETKG RKVYEAMRKA LQHGTVFDEQ LSDDPSAEEA  120
EQGEAYMMED SIAQDDAAGA KEVSNNADSD EGGPVKLVTY SDSEDA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446215.11e-26hypothetical protein SORBIDRAFT_06g004760
TrEMBLK3YEV57e-34K3YEV5_SETIT; Uncharacterized protein
STRINGSi012772m2e-33(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59202345